SCOPe 2.03: Domain d1x0gd_: 1x0g D:

Lineage for d1x0gd_ (1x0g D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.124: HesB-like domain [89359] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.124.1: HesB-like domain [89360] (2 families)

5. Family b.124.1.0: automated matches [227171] (1 protein)
   not a true family

6. Protein automated matches [226886] (1 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [225076] (1 PDB entry)

8. Domain d1x0gd_: 1x0g D: [203052]
   automated match to d1nwba_
   complexed with fes, na

Details for d1x0gd_

PDB Entry: 1x0g, 2.5 Å

PDB Description: Crystal Structure of IscA with the [2Fe-2S] cluster

PDB Compounds: (D:) IscA

SCOPe Domain Sequences for d1x0gd_:

Sequence, based on SEQRES records:

>d1x0gd_ b.124.1.0 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq
gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvs

Sequence, based on observed residues (ATOM records):

>d1x0gd_ b.124.1.0 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mveltpaaiqelerlqthaailriqvqpsecgdwrydlalvaepkptdlltqsqgwtiai
aaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvs

Timeline for d1x0gd_:

• d1x0gd_ is new in SCOPe 2.03-stable
  
• d1x0gd_ appears in SCOPe 2.04
  
• d1x0gd_ appears in the current release, SCOPe 2.08