![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.124: HesB-like domain [89359] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
![]() | Superfamily b.124.1: HesB-like domain [89360] (2 families) ![]() |
![]() | Family b.124.1.0: automated matches [227171] (1 protein) not a true family |
![]() | Protein automated matches [226886] (1 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [225076] (1 PDB entry) |
![]() | Domain d1x0gd_: 1x0g D: [203052] automated match to d1nwba_ complexed with fes, na |
PDB Entry: 1x0g (more details), 2.5 Å
SCOPe Domain Sequences for d1x0gd_:
Sequence, based on SEQRES records: (download)
>d1x0gd_ b.124.1.0 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mveltpaaiqelerlqthgvrrgqaailriqvqpsecgdwrydlalvaepkptdlltqsq gwtiaiaaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvs
>d1x0gd_ b.124.1.0 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mveltpaaiqelerlqthaailriqvqpsecgdwrydlalvaepkptdlltqsqgwtiai aaeaaellrglrvdyiedlmggafrfhnpnasqtcgcgmafrvs
Timeline for d1x0gd_: