SCOPe 2.08: Domain d1a5fh1: 1a5f H:1-120

Lineage for d1a5fh1 (1a5f H:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d1a5fh1: 1a5f H:1-120 [20303]
   Other proteins in same PDB: d1a5fh2, d1a5fl1, d1a5fl2
   part of an anti-E-selectin Fab

Details for d1a5fh1

PDB Entry: 1a5f, 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody

PDB Compounds: (H:) monoclonal anti-e-selectin 7a9 antibody (heavy chain)

SCOPe Domain Sequences for d1a5fh1:

Sequence, based on SEQRES records:

>d1a5fh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
dptfkgkatitaddssntaylqmssltsedtavyycarvglsywyamdywgqgtsvtvss

Sequence, based on observed residues (ATOM records):

>d1a5fh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
dptfkgkatitaddssntaylqmssltsedtavyycarvyamdywgqgtsvtvss

Timeline for d1a5fh1:

• d1a5fh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a5fh1 appears in SCOPe 2.07