Lineage for d1wpqa1 (1wpq A:2-193)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455436Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries)
  8. 2455594Domain d1wpqa1: 1wpq A:2-193 [203013]
    Other proteins in same PDB: d1wpqa2, d1wpqb2
    automated match to d1evya2
    complexed with 13p, nad, so4

Details for d1wpqa1

PDB Entry: 1wpq (more details), 2.5 Å

PDB Description: Ternary Complex Of Glycerol 3-phosphate Dehydrogenase 1 with NAD and dihydroxyactone
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1wpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpqa1 c.2.1.0 (A:2-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanptgislikg
vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
qtpnfritvvqe

SCOPe Domain Coordinates for d1wpqa1:

Click to download the PDB-style file with coordinates for d1wpqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wpqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpqa2