Lineage for d1vf4a1 (1vf4 A:2-80)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134188Species Chicken (Gallus gallus) [TaxId:9031] [225005] (4 PDB entries)
  8. 2134194Domain d1vf4a1: 1vf4 A:2-80 [202952]
    Other proteins in same PDB: d1vf4a2
    automated match to d1f3ba2
    complexed with acy

Details for d1vf4a1

PDB Entry: 1vf4 (more details), 2.45 Å

PDB Description: cgsta1-1 apo form
PDB Compounds: (A:) Glutathione S-transferase 3

SCOPe Domain Sequences for d1vf4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf4a1 c.47.1.0 (A:2-80) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aakpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmveid
gmklvqtrailnyiagkyn

SCOPe Domain Coordinates for d1vf4a1:

Click to download the PDB-style file with coordinates for d1vf4a1.
(The format of our PDB-style files is described here.)

Timeline for d1vf4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vf4a2