Lineage for d1vf1a2 (1vf1 A:81-228)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1492375Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1492376Protein automated matches [226831] (41 species)
    not a true protein
  7. 1492445Species Chicken (Gallus gallus) [TaxId:9031] [225006] (4 PDB entries)
  8. 1492446Domain d1vf1a2: 1vf1 A:81-228 [202943]
    Other proteins in same PDB: d1vf1a1
    automated match to d1f3aa1
    complexed with gsh

Details for d1vf1a2

PDB Entry: 1vf1 (more details), 1.77 Å

PDB Description: cgsta1-1 in complex with glutathione
PDB Compounds: (A:) Glutathione S-transferase 3

SCOPe Domain Sequences for d1vf1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf1a2 a.45.1.0 (A:81-228) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lygkdlkeralidmyvggtddlmgfllsfpflsaedkvkqcafvvekatsryfpayekvl
kdhgqdflvgnrlswadihlleailmveekksdalsgfpllqafkkrissiptikkflap
gskrkpisddkyvetvrrvlrmyydvkp

SCOPe Domain Coordinates for d1vf1a2:

Click to download the PDB-style file with coordinates for d1vf1a2.
(The format of our PDB-style files is described here.)

Timeline for d1vf1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vf1a1