| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (239 species) not a true protein |
| Species Carp (Cyprinus carpio) [TaxId:7962] [224961] (1 PDB entry) |
| Domain d1v6ab1: 1v6a B:1-160 [202935] Other proteins in same PDB: d1v6aa2, d1v6ab2 automated match to d9ldta1 complexed with tre |
PDB Entry: 1v6a (more details), 2.3 Å
SCOPe Domain Sequences for d1v6ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6ab1 c.2.1.0 (B:1-160) automated matches {Carp (Cyprinus carpio) [TaxId: 7962]}
astkeklithvskeepagptnkvtvvgvgmvgmaaaisillkdltdelalvdvmedklkg
eamdlqhgslflkthkivadkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfi
ipniikyspncillvvsnpvdiltyvawklsglprnrvig
Timeline for d1v6ab1: