Lineage for d1v6ab1 (1v6a B:1-160)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107351Species Carp (Cyprinus carpio) [TaxId:7962] [224961] (1 PDB entry)
  8. 2107353Domain d1v6ab1: 1v6a B:1-160 [202935]
    Other proteins in same PDB: d1v6aa2, d1v6ab2
    automated match to d9ldta1
    complexed with tre

Details for d1v6ab1

PDB Entry: 1v6a (more details), 2.3 Å

PDB Description: crystal structure of l-lactate dehydrogenase from cyprinus carpio
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d1v6ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6ab1 c.2.1.0 (B:1-160) automated matches {Carp (Cyprinus carpio) [TaxId: 7962]}
astkeklithvskeepagptnkvtvvgvgmvgmaaaisillkdltdelalvdvmedklkg
eamdlqhgslflkthkivadkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfi
ipniikyspncillvvsnpvdiltyvawklsglprnrvig

SCOPe Domain Coordinates for d1v6ab1:

Click to download the PDB-style file with coordinates for d1v6ab1.
(The format of our PDB-style files is described here.)

Timeline for d1v6ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6ab2