Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein automated matches [190702] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [189730] (4 PDB entries) |
Domain d1u9mb_: 1u9m B: [202927] automated match to d1cyoa_ complexed with hem; mutant |
PDB Entry: 1u9m (more details), 2 Å
SCOPe Domain Sequences for d1u9mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9mb_ d.120.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenwedvg hstdarelsktfiigelhpddr
Timeline for d1u9mb_: