Lineage for d4kq6h_ (4kq6 H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1585842Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1585843Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 1585844Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 1586003Protein automated matches [190461] (5 species)
    not a true protein
  7. 1586010Species Candida glabrata [TaxId:284593] [193568] (1 PDB entry)
  8. 1586018Domain d4kq6h_: 4kq6 H: [202872]
    complexed with dlz, gol, so4

Details for d4kq6h_

PDB Entry: 4kq6 (more details), 2.24 Å

PDB Description: Product complex of lumazine synthase from candida glabrata
PDB Compounds: (H:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d4kq6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kq6h_ c.16.1.1 (H:) automated matches {Candida glabrata [TaxId: 284593]}
qnydgsklrvgiiharwnrviidalvkgaidrmlslgvkeeniivetvpgsfelpygskr
faekqakkgepldvvipigvlikgstmhfeyisdsttqaimnlqdkinipvifglltclt
eeqalaragidegktmhnhgedwgaaavematkfgana

SCOPe Domain Coordinates for d4kq6h_:

Click to download the PDB-style file with coordinates for d4kq6h_.
(The format of our PDB-style files is described here.)

Timeline for d4kq6h_: