SCOPe 2.08: Domain d4jtdg_: 4jtd G:

Lineage for d4jtdg_ (4jtd G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (12 PDB entries)

8. Domain d4jtdg_: 4jtd G: [202797]
   Other proteins in same PDB: d4jtdy_
   automated match to d2a79a_
   complexed with k, nap, pgw; mutant

Details for d4jtdg_

PDB Entry: 4jtd, 2.54 Å

PDB Description: crystal structure of kv1.2-2.1 paddle chimera channel in complex with lys27met mutant of charybdotoxin

PDB Compounds: (G:) Voltage-gated potassium channel subunit beta-2

SCOPe Domain Sequences for d4jtdg_:

Sequence; same for both SEQRES and ATOM records:

>d4jtdg_ c.1.7.1 (G:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
aiqvlpklsssivheidsilgnkpys

Timeline for d4jtdg_:

• d4jtdg_ first appeared in SCOPe 2.03
  
• d4jtdg_ appears in SCOPe 2.07