| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
| Protein automated matches [190646] (77 species) not a true protein |
| Species Rhodobacter sphaeroides [TaxId:349102] [196798] (1 PDB entry) |
| Domain d4joqb_: 4joq B: [202752] Other proteins in same PDB: d4joqa2 automated match to d4joqa_ complexed with act, edo |
PDB Entry: 4joq (more details), 1.9 Å
SCOPe Domain Sequences for d4joqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4joqb_ c.93.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 349102]}
aqekvgtigiaipsathgfmgglnfhaqdtikrlqevypqldfvlatagnagkmvndied
mvatrnisalvvlpfesepltspvqavkeagiwvtvvdrglsvegiedlyvagdnpgfgr
vageyfaqhlesgkkivvlrgipttldnerveaftaaiegsgievldmqhgnwnrddafn
vmqdflskypqidavwaadddmaigameaiaqagrteemwvmggagmkeiirriadgdpq
lpanvtyppaqistaieltalklvsstpvsgrfiigsqlvtpenaeqfyfpdspf
Timeline for d4joqb_: