SCOPe 2.08: Domain d4joqb_: 4joq B:

Lineage for d4joqb_ (4joq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:349102] [196798] (1 PDB entry)

8. Domain d4joqb_: 4joq B: [202752]
   Other proteins in same PDB: d4joqa2
   automated match to d4joqa_
   complexed with act, edo

Details for d4joqb_

PDB Entry: 4joq, 1.9 Å

PDB Description: putative ribose abc transporter, periplasmic solute-binding protein from rhodobacter sphaeroides

PDB Compounds: (B:) ABC ribose transporter, periplasmic solute-binding protein

SCOPe Domain Sequences for d4joqb_:

Sequence; same for both SEQRES and ATOM records:

>d4joqb_ c.93.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 349102]}
aqekvgtigiaipsathgfmgglnfhaqdtikrlqevypqldfvlatagnagkmvndied
mvatrnisalvvlpfesepltspvqavkeagiwvtvvdrglsvegiedlyvagdnpgfgr
vageyfaqhlesgkkivvlrgipttldnerveaftaaiegsgievldmqhgnwnrddafn
vmqdflskypqidavwaadddmaigameaiaqagrteemwvmggagmkeiirriadgdpq
lpanvtyppaqistaieltalklvsstpvsgrfiigsqlvtpenaeqfyfpdspf

Timeline for d4joqb_:

• d4joqb_ first appeared in SCOPe 2.03
  
• d4joqb_ appears in SCOPe 2.07