Lineage for d4joqb_ (4joq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913513Species Rhodobacter sphaeroides [TaxId:349102] [196798] (1 PDB entry)
  8. 2913515Domain d4joqb_: 4joq B: [202752]
    Other proteins in same PDB: d4joqa2
    automated match to d4joqa_
    complexed with act, edo

Details for d4joqb_

PDB Entry: 4joq (more details), 1.9 Å

PDB Description: putative ribose abc transporter, periplasmic solute-binding protein from rhodobacter sphaeroides
PDB Compounds: (B:) ABC ribose transporter, periplasmic solute-binding protein

SCOPe Domain Sequences for d4joqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4joqb_ c.93.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 349102]}
aqekvgtigiaipsathgfmgglnfhaqdtikrlqevypqldfvlatagnagkmvndied
mvatrnisalvvlpfesepltspvqavkeagiwvtvvdrglsvegiedlyvagdnpgfgr
vageyfaqhlesgkkivvlrgipttldnerveaftaaiegsgievldmqhgnwnrddafn
vmqdflskypqidavwaadddmaigameaiaqagrteemwvmggagmkeiirriadgdpq
lpanvtyppaqistaieltalklvsstpvsgrfiigsqlvtpenaeqfyfpdspf

SCOPe Domain Coordinates for d4joqb_:

Click to download the PDB-style file with coordinates for d4joqb_.
(The format of our PDB-style files is described here.)

Timeline for d4joqb_: