SCOPe 2.04: Domain d4j7ka_: 4j7k A:

Lineage for d4j7ka_ (4j7k A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.0: automated matches [193224] (1 protein)
   not a true family

6. Protein automated matches [193225] (4 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [193226] (8 PDB entries)

8. Domain d4j7ka_: 4j7k A: [202719]
   automated match to d4j7kd_
   mutant

Details for d4j7ka_

PDB Entry: 4j7k, 1.66 Å

PDB Description: The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne

PDB Compounds: (A:) Secreted protein EsxB

SCOPe Domain Sequences for d4j7ka_:

Sequence; same for both SEQRES and ATOM records:

>d4j7ka_ a.25.3.0 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
namaeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgqfiqs
kqamqqyipilegistdlkriadkfrntdn

Timeline for d4j7ka_:

• d4j7ka_ first appeared in SCOPe 2.03
  
• d4j7ka_ appears in SCOPe 2.05
  
• d4j7ka_ appears in the current release, SCOPe 2.08, called d4j7ka1