Lineage for d4j41c_ (4j41 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318581Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2318595Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 2318596Protein automated matches [193225] (4 species)
    not a true protein
  7. 2318597Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries)
  8. 2318616Domain d4j41c_: 4j41 C: [202690]
    Other proteins in same PDB: d4j41a2
    automated match to d4j41d_
    complexed with act, fmt, peg; mutant

Details for d4j41c_

PDB Entry: 4j41 (more details), 1.52 Å

PDB Description: The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
PDB Compounds: (C:) Secreted protein EsxB

SCOPe Domain Sequences for d4j41c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j41c_ a.25.3.0 (C:) automated matches {Bacillus anthracis [TaxId: 260799]}
kitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskqamqq
yiailegistdlkriadkfrn

SCOPe Domain Coordinates for d4j41c_:

Click to download the PDB-style file with coordinates for d4j41c_.
(The format of our PDB-style files is described here.)

Timeline for d4j41c_: