SCOPe 2.04: Domain d4j2jb_: 4j2j B:

Lineage for d4j2jb_ (4j2j B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.1: AXH domain [102032] (2 proteins)

6. Protein automated matches [196747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)

8. Domain d4j2jb_: 4j2j B: [202684]
   automated match to d4j2ja_

Details for d4j2jb_

PDB Entry: 4j2j, 2.5 Å

PDB Description: Crystal structure of AXH domain complex with Capicua

PDB Compounds: (B:) ataxin-1

SCOPe Domain Sequences for d4j2jb_:

Sequence, based on SEQRES records:

>d4j2jb_ b.145.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptlppyfmkgsmiqlangelkkvedlktedfiqsaemsndlkidsstveriedshspgva
viqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisltl
k

Sequence, based on observed residues (ATOM records):

>d4j2jb_ b.145.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptlppyfmkgsmiqlangelkkvedlktedfiqsaemsndlkidsstveriedshvaviq
favgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisltlk

Timeline for d4j2jb_:

• d4j2jb_ first appeared in SCOPe 2.03
  
• d4j2jb_ appears in SCOPe 2.05
  
• d4j2jb_ appears in the current release, SCOPe 2.08