Lineage for d1a6ul_ (1a6u L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288351Species Mouse (Mus musculus) [TaxId:10090] [88541] (25 PDB entries)
  8. 288354Domain d1a6ul_: 1a6u L: [20254]
    Other proteins in same PDB: d1a6uh_
    part of Fv B1-8

Details for d1a6ul_

PDB Entry: 1a6u (more details), 2 Å

PDB Description: b1-8 fv fragment

SCOP Domain Sequences for d1a6ul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6ul_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOP Domain Coordinates for d1a6ul_:

Click to download the PDB-style file with coordinates for d1a6ul_.
(The format of our PDB-style files is described here.)

Timeline for d1a6ul_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a6uh_