Lineage for d1a6ul_ (1a6u L:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fv B1-8 (mouse), lambda L chain [48853] (3 PDB entries) 
Domain d1a6ul_: 1a6u L: [20254]
Details for d1a6ul_
PDB Entry: 1a6u (more details), 2 Å
PDB Description: b1-8 fv fragment
SCOP Domain Sequences for d1a6ul_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6ul_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv B1-8 (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
SCOP Domain Coordinates for d1a6ul_:
Click to download the PDB-style file with coordinates for d1a6ul_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a6ul_:
- d1a6ul_ appears in SCOP 1.57
- d1a6ul_ appears in the current release, SCOPe 2.08
View in 3D
