Lineage for d4i3dd_ (4i3d D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1552171Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1552427Protein automated matches [190295] (5 species)
    not a true protein
  7. 1552430Species Eel (Anguilla japonica) [TaxId:7937] [197394] (3 PDB entries)
  8. 1552442Domain d4i3dd_: 4i3d D: [202533]
    automated match to d4i3da_
    complexed with bla; mutant

Details for d4i3dd_

PDB Entry: 4i3d (more details), 2.3 Å

PDB Description: Crystal structure of fluorescent protein UnaG N57A mutant
PDB Compounds: (D:) Fatty acid binding protein-like

SCOPe Domain Sequences for d4i3dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i3dd_ b.60.1.2 (D:) automated matches {Eel (Anguilla japonica) [TaxId: 7937]}
mvekfvgtwkiadshnfgeylkaigapkelsdggdattptlyisqkdgdkmtvkieagpp
tfldtqvkfklgeefdefpsdrrkgvksvvnlvgeklvyvqkwdgkettyvreikdgklv
vtltmgdvvavrsyrrate

SCOPe Domain Coordinates for d4i3dd_:

Click to download the PDB-style file with coordinates for d4i3dd_.
(The format of our PDB-style files is described here.)

Timeline for d4i3dd_: