Lineage for d4hn1b1 (4hn1 B:1-196)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424817Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries)
  8. 2424819Domain d4hn1b1: 4hn1 B:1-196 [202451]
    Other proteins in same PDB: d4hn1a2, d4hn1b2, d4hn1c2, d4hn1d2
    automated match to d4hn1a_
    complexed with edo, tdr, thm, tyd; mutant

Details for d4hn1b1

PDB Entry: 4hn1 (more details), 1.6 Å

PDB Description: Crystal Structure of H60N/Y130F double mutant of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP
PDB Compounds: (B:) Putative 3-epimerase in D-allose pathway

SCOPe Domain Sequences for d4hn1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hn1b1 b.82.1.0 (B:1-196) automated matches {Streptomyces bikiniensis [TaxId: 1896]}
mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin
yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
llptyqawqeqqqaqr

SCOPe Domain Coordinates for d4hn1b1:

Click to download the PDB-style file with coordinates for d4hn1b1.
(The format of our PDB-style files is described here.)

Timeline for d4hn1b1: