Lineage for d4hhhb1 (4hhh B:12-149)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416218Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1416470Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1416471Protein automated matches [226983] (10 species)
    not a true protein
  7. 1416511Species Pea (Pisum sativum) [TaxId:3888] [226513] (2 PDB entries)
  8. 1416517Domain d4hhhb1: 4hhh B:12-149 [202425]
    Other proteins in same PDB: d4hhha2, d4hhhb2, d4hhhc2, d4hhhd2, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_
    automated match to d1gk8a2
    complexed with rub

Details for d4hhhb1

PDB Entry: 4hhh (more details), 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4hhhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhhb1 d.58.9.0 (B:12-149) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripyayvktfq

SCOPe Domain Coordinates for d4hhhb1:

Click to download the PDB-style file with coordinates for d4hhhb1.
(The format of our PDB-style files is described here.)

Timeline for d4hhhb1: