SCOPe 2.03: Domain d4hhha1: 4hhh A:12-149

Lineage for d4hhha1 (4hhh A:12-149)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (10 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [226513] (2 PDB entries)

8. Domain d4hhha1: 4hhh A:12-149 [202423]
   Other proteins in same PDB: d4hhha2, d4hhhb2, d4hhhc2, d4hhhd2, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_
   automated match to d1gk8a2
   complexed with rub

Details for d4hhha1

PDB Entry: 4hhh, 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco

PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4hhha1:

Sequence; same for both SEQRES and ATOM records:

>d4hhha1 d.58.9.0 (A:12-149) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripyayvktfq

Timeline for d4hhha1:

• d4hhha1 is new in SCOPe 2.03-stable
  
• d4hhha1 appears in SCOPe 2.04
  
• d4hhha1 appears in the current release, SCOPe 2.08