Lineage for d4h6bk_ (4h6b K:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565570Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 1565571Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 1565572Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 1565593Protein automated matches [190385] (2 species)
    not a true protein
  7. 1565594Species Physcomitrella patens [TaxId:3218] [193452] (2 PDB entries)
  8. 1565617Domain d4h6bk_: 4h6b K: [202383]
    automated match to d4h6bb_
    complexed with 10x, 10y, hez, po4

Details for d4h6bk_

PDB Entry: 4h6b (more details), 1.35 Å

PDB Description: structural basis for allene oxide cyclization in moss
PDB Compounds: (K:) allene oxide cyclase

SCOPe Domain Sequences for d4h6bk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h6bk_ b.159.1.1 (K:) automated matches {Physcomitrella patens [TaxId: 3218]}
hvqelfvyeinerdrgspvflpfggkkqpgtdahvnslgdlvpfsnkiydgslktrlgit
aglctlishsdqkngdryealysfyfgdyghisvqgpyityedsylaitggsgifagcyg
qaklhqiifpfklfytfylqgikklpealcapcvppspsvapadeakqclpnhvapnftk

SCOPe Domain Coordinates for d4h6bk_:

Click to download the PDB-style file with coordinates for d4h6bk_.
(The format of our PDB-style files is described here.)

Timeline for d4h6bk_: