Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (26 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [193479] (1 PDB entry) |
Domain d4h4gc_: 4h4g C: [202360] automated match to d4h4gi_ |
PDB Entry: 4h4g (more details), 2.65 Å
SCOPe Domain Sequences for d4h4gc_:
Sequence, based on SEQRES records: (download)
>d4h4gc_ d.38.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]} nfdihkiltllphrypillvdrvlelephksikalknvtvnepfftghfpkrpvmpgvli iealaqaaalltfaeaepkdpentlyyfvgidnarfkrvvepgdqlilnvtferyirgiw kfkavaevdgkvaaeaelmctvkt
>d4h4gc_ d.38.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]} nfdihkiltllphrypillvdrvlelephksikalknvtvnepfftghfpkrpvmpgvli iealaqaaalltfaeatlyyfvgidnarfkrvvepgdqlilnvtferyirgiwkfkavae vdgkvaaeaelmctvkt
Timeline for d4h4gc_: