Lineage for d4gvob_ (4gvo B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880596Species Listeria monocytogenes [TaxId:169963] [193523] (2 PDB entries)
  8. 1880598Domain d4gvob_: 4gvo B: [202304]
    automated match to d4gvoa_
    complexed with cl, csx, his, na

Details for d4gvob_

PDB Entry: 4gvo (more details), 1.45 Å

PDB Description: Putative L-Cystine ABC transporter from Listeria monocytogenes
PDB Compounds: (B:) Lmo2349 protein

SCOPe Domain Sequences for d4gvob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gvob_ c.94.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
vqtitvgtgtqfpnvcfldengkltgydvelvkeidkrlpgykfkfktmdfsnllvslga
gkvdivahqmekskerekkflfndvaynnfplqltvldsnnsinstkdlagkrvitsats
ngalvlkkineeqgnnfeiayegqgsndtanqlktgradatistpfavdfqnktsaikek
vvgdvlsnakvyfmlgkdetklskkvdealqsiiddgtlkklsekwlgadyskeqy

SCOPe Domain Coordinates for d4gvob_:

Click to download the PDB-style file with coordinates for d4gvob_.
(The format of our PDB-style files is described here.)

Timeline for d4gvob_: