SCOPe 2.08: Domain d4gvob_: 4gvo B:

Lineage for d4gvob_ (4gvo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries)

8. Domain d4gvob_: 4gvo B: [202304]
   automated match to d4gvoa_
   complexed with cl, csx, his, na

Details for d4gvob_

PDB Entry: 4gvo, 1.45 Å

PDB Description: Putative L-Cystine ABC transporter from Listeria monocytogenes

PDB Compounds: (B:) Lmo2349 protein

SCOPe Domain Sequences for d4gvob_:

Sequence; same for both SEQRES and ATOM records:

>d4gvob_ c.94.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
vqtitvgtgtqfpnvcfldengkltgydvelvkeidkrlpgykfkfktmdfsnllvslga
gkvdivahqmekskerekkflfndvaynnfplqltvldsnnsinstkdlagkrvitsats
ngalvlkkineeqgnnfeiayegqgsndtanqlktgradatistpfavdfqnktsaikek
vvgdvlsnakvyfmlgkdetklskkvdealqsiiddgtlkklsekwlgadyskeqy

Timeline for d4gvob_:

• d4gvob_ first appeared in SCOPe 2.03
  
• d4gvob_ appears in SCOPe 2.07