Lineage for d4fzcn_ (4fzc N:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438672Domain d4fzcn_: 4fzc N: [202158]
    Other proteins in same PDB: d4fzcd_, d4fzcg_, d4fzck_, d4fzcr_, d4fzcu_, d4fzcy_
    automated match to d1g0un_

Details for d4fzcn_

PDB Entry: 4fzc (more details), 2.8 Å

PDB Description: 20s yeast proteasome in complex with cepafungin i
PDB Compounds: (N:) Proteasome component PRE3

SCOPe Domain Sequences for d4fzcn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fzcn_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d4fzcn_:

Click to download the PDB-style file with coordinates for d4fzcn_.
(The format of our PDB-style files is described here.)

Timeline for d4fzcn_: