Lineage for d4fzcb_ (4fzc B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438663Domain d4fzcb_: 4fzc B: [202149]
    Other proteins in same PDB: d4fzcd_, d4fzcg_, d4fzck_, d4fzcr_, d4fzcu_, d4fzcy_
    automated match to d1jd2w_

Details for d4fzcb_

PDB Entry: 4fzc (more details), 2.8 Å

PDB Description: 20s yeast proteasome in complex with cepafungin i
PDB Compounds: (B:) Proteasome component Y13

SCOPe Domain Sequences for d4fzcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fzcb_ d.153.1.4 (B:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4fzcb_:

Click to download the PDB-style file with coordinates for d4fzcb_.
(The format of our PDB-style files is described here.)

Timeline for d4fzcb_: