Lineage for d4fxbb_ (4fxb B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005894Species Streptomyces coelicolor [TaxId:100226] [193380] (1 PDB entry)
  8. 2005896Domain d4fxbb_: 4fxb B: [202144]
    automated match to d4fxba_
    complexed with hem

Details for d4fxbb_

PDB Entry: 4fxb (more details), 2.9 Å

PDB Description: Crystal structure of CYP105N1 from Streptomyces coelicolor: a cytochrome P450 oxidase in the coelibactin siderophore biosynthetic pathway
PDB Compounds: (B:) putative cytochrome P450

SCOPe Domain Sequences for d4fxbb_:

Sequence, based on SEQRES records: (download)

>d4fxbb_ a.104.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
prdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsadi
rrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvdei
ldgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvsea
lgglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagretttsm
ialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvpa
ddgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevaletl
lrrvptlrlagerdqvvvkhdsatfgleelmvt

Sequence, based on observed residues (ATOM records): (download)

>d4fxbb_ a.104.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
prdfpifaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsadirrpgf
rpfirtdapehtryrrmllpaftvrrvramrpavqarvdeildgmlaaggpvdlvsayan
avstsvicellgiprhdleffrdvtrisgsraeqvsealgglfgllgglvaerreeprdd
lisklvtdhlvpgnvtteqllstlgitinagretttsmialstlllldrpelpaelrkdp
dlmpaavdellrvlsvadsiplrvaaedielsgrtvpaddgviallaganhdpeqfddpe
rvdfhrtdnhhvafgygvhqcvgqhlarlelevaletllrrvptlrlaerdqvvvkhdsa
tfgleelmvt

SCOPe Domain Coordinates for d4fxbb_:

Click to download the PDB-style file with coordinates for d4fxbb_.
(The format of our PDB-style files is described here.)

Timeline for d4fxbb_: