SCOPe 2.06: Domain d4fure_: 4fur E:

Lineage for d4fure_ (4fur E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.0: automated matches [193589] (1 protein)
   not a true family

6. Protein automated matches [193590] (3 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [193591] (1 PDB entry)

8. Domain d4fure_: 4fur E: [202138]
   automated match to d4furd_
   complexed with cl, edo

Details for d4fure_

PDB Entry: 4fur, 2.1 Å

PDB Description: Crystal Structure of Urease subunit gamma 2 from Brucella melitensis biovar Abortus 2308

PDB Compounds: (E:) Urease subunit gamma 2

SCOPe Domain Sequences for d4fure_:

Sequence; same for both SEQRES and ATOM records:

>d4fure_ d.8.1.0 (E:) automated matches {Brucella melitensis [TaxId: 359391]}
mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit

Timeline for d4fure_:

• d4fure_ first appeared in SCOPe 2.03
  
• d4fure_ appears in SCOPe 2.05
  
• d4fure_ appears in SCOPe 2.07
  
• d4fure_ appears in the current release, SCOPe 2.08