Lineage for d4fslb_ (4fsl B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2069061Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2069119Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2069120Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2069474Domain d4fslb_: 4fsl B: [202133]
    automated match to d3ckpa_
    complexed with 0vb, iod

Details for d4fslb_

PDB Entry: 4fsl (more details), 2.5 Å

PDB Description: crystal structure of beta-site app-cleaving enzyme 1 (bace-db-mut) complex with n-(n-(4- acetamido-3-chloro-5-methylbenzyl) carbamimidoyl)-3-(4- methoxyphenyl)-5-methyl-4-isothiazolecarboxamide
PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d4fslb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fslb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d4fslb_:

Click to download the PDB-style file with coordinates for d4fslb_.
(The format of our PDB-style files is described here.)

Timeline for d4fslb_: