Lineage for d4fq9e_ (4fq9 E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646175Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 1646186Protein automated matches [191220] (2 species)
    not a true protein
  7. 1646187Species Pseudomonas aeruginosa [TaxId:208964] [193354] (6 PDB entries)
  8. 1646199Domain d4fq9e_: 4fq9 E: [202116]
    automated match to d4fq9d_
    complexed with gol, po4

Details for d4fq9e_

PDB Entry: 4fq9 (more details), 2.02 Å

PDB Description: Crystal Structure of 3-hydroxydecanoyl-Acyl Carrier Protein Dehydratase (FabA) from Pseudomonas aeruginosa
PDB Compounds: (E:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4fq9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fq9e_ d.38.1.2 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstdsf

SCOPe Domain Coordinates for d4fq9e_:

Click to download the PDB-style file with coordinates for d4fq9e_.
(The format of our PDB-style files is described here.)

Timeline for d4fq9e_: