SCOPe 2.06: Domain d1ar1d_: 1ar1 D:

Lineage for d1ar1d_ (1ar1 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (220 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d1ar1d_: 1ar1 D: [20206]
   Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2, d1ar1c_
   part of Fv against Paracoccus denitrificans cytochrome c oxidase
   complexed with ca, cu, hea, lda, mg

Details for d1ar1d_

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

PDB Compounds: (D:) antibody fv fragment

SCOPe Domain Sequences for d1ar1d_:

Sequence; same for both SEQRES and ATOM records:

>d1ar1d_ b.1.1.1 (D:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

Timeline for d1ar1d_:

• d1ar1d_ first appeared (with stable ids) in SCOP 1.55
  
• d1ar1d_ appears in SCOPe 2.05
  
• d1ar1d_ appears in SCOPe 2.07
  
• d1ar1d_ appears in the current release, SCOPe 2.08