Lineage for d4fjwf_ (4fjw F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854044Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries)
  8. 2854049Domain d4fjwf_: 4fjw F: [202040]
    automated match to d4fjwd_

Details for d4fjwf_

PDB Entry: 4fjw (more details), 2.2 Å

PDB Description: Crystal Structure of the apo form of the E131Q Mtb crotonase
PDB Compounds: (F:) Probable enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d4fjwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjwf_ c.14.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka
faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli
aadtakfgqpqiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv
paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs
egmaafiekrapqft

SCOPe Domain Coordinates for d4fjwf_:

Click to download the PDB-style file with coordinates for d4fjwf_.
(The format of our PDB-style files is described here.)

Timeline for d4fjwf_: