Lineage for d4epbc2 (4epb C:1130-1422,C:1476-1567)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1341531Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 1341532Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 1341541Species Enterobacter aerogenes [TaxId:548] [224877] (4 PDB entries)
  8. 1341544Domain d4epbc2: 4epb C:1130-1422,C:1476-1567 [201937]
    Other proteins in same PDB: d4epba_, d4epbb_, d4epbc1
    automated match to d1ef2a2
    complexed with ni

Details for d4epbc2

PDB Entry: 4epb (more details), 1.75 Å

PDB Description: Final Urease Structure for Radiation Damage Experiment at 100 K
PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4epbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4epbc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Enterobacter aerogenes [TaxId: 548]}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOPe Domain Coordinates for d4epbc2:

Click to download the PDB-style file with coordinates for d4epbc2.
(The format of our PDB-style files is described here.)

Timeline for d4epbc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4epbc1