Lineage for d4epbc1 (4epb C:1002-1129,C:1423-1475)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333200Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1333201Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1333202Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 1333203Protein alpha-Subunit of urease [51340] (4 species)
  7. 1333212Species Enterobacter aerogenes [TaxId:548] [224871] (4 PDB entries)
  8. 1333215Domain d4epbc1: 4epb C:1002-1129,C:1423-1475 [201936]
    Other proteins in same PDB: d4epba_, d4epbb_, d4epbc2
    automated match to d1ef2a1
    complexed with ni

Details for d4epbc1

PDB Entry: 4epb (more details), 1.75 Å

PDB Description: Final Urease Structure for Radiation Damage Experiment at 100 K
PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4epbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4epbc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Enterobacter aerogenes [TaxId: 548]}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOPe Domain Coordinates for d4epbc1:

Click to download the PDB-style file with coordinates for d4epbc1.
(The format of our PDB-style files is described here.)

Timeline for d4epbc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4epbc2