Lineage for d4eood1 (4eoo D:176-309)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495418Protein Cyclin A [47956] (2 species)
  7. 1495454Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
    Uniprot P20248 175-432
  8. 1495501Domain d4eood1: 4eoo D:176-309 [201913]
    Other proteins in same PDB: d4eooa_, d4eooc_
    automated match to d1h1pb1
    complexed with atp, mg, sgm

Details for d4eood1

PDB Entry: 4eoo (more details), 2.1 Å

PDB Description: Thr 160 phosphorylated CDK2 Q131E - human cyclin A3 complex with ATP
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eood1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eood1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

SCOPe Domain Coordinates for d4eood1:

Click to download the PDB-style file with coordinates for d4eood1.
(The format of our PDB-style files is described here.)

Timeline for d4eood1: