Lineage for d4eoid1 (4eoi D:178-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718141Domain d4eoid1: 4eoi D:178-309 [201890]
    Other proteins in same PDB: d4eoia1, d4eoia2, d4eoic1, d4eoic2
    automated match to d1h1pb1
    complexed with 1ro, dms, sgm

Details for d4eoid1

PDB Entry: 4eoi (more details), 2 Å

PDB Description: Thr 160 phosphorylated CDK2 K89D, Q131E - human cyclin A3 complex with the inhibitor RO3306
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eoid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eoid1 a.74.1.1 (D:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
vlkvltfdlaap

SCOPe Domain Coordinates for d4eoid1:

Click to download the PDB-style file with coordinates for d4eoid1.
(The format of our PDB-style files is described here.)

Timeline for d4eoid1: