Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d4d9ql1: 4d9q L:1-107 [201648] Other proteins in same PDB: d4d9qa_, d4d9qb_, d4d9qd2, d4d9ql2 automated match to d3fcta1 complexed with gol, so4, zn |
PDB Entry: 4d9q (more details), 2.28 Å
SCOPe Domain Sequences for d4d9ql1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d9ql1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqvtqspsslsasvgdrvtitcitstdidddmnwyqqkpgkvpkllisggntlrpgvps rfsgsgsgtdftltisslqpedvatyyclqsdslpytfgqgtkveik
Timeline for d4d9ql1:
View in 3D Domains from other chains: (mouse over for more information) d4d9qa_, d4d9qb_, d4d9qd1, d4d9qd2 |