SCOPe 2.03: Domain d4d9qd2: 4d9q D:108-213

Lineage for d4d9qd2 (4d9q D:108-213)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d4d9qd2: 4d9q D:108-213 [201647]
   Other proteins in same PDB: d4d9qa_, d4d9qb_, d4d9qd1, d4d9ql1
   automated match to d3fcta2
   complexed with gol, so4, zn

Details for d4d9qd2

PDB Entry: 4d9q, 2.28 Å

PDB Description: inhibiting alternative pathway complement activation by targeting the exosite on factor d

PDB Compounds: (D:) Anti-Factor D, light chain

SCOPe Domain Sequences for d4d9qd2:

Sequence; same for both SEQRES and ATOM records:

>d4d9qd2 b.1.1.2 (D:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4d9qd2:

• d4d9qd2 is new in SCOPe 2.03-stable
  
• d4d9qd2 appears in SCOPe 2.04
  
• d4d9qd2 appears in the current release, SCOPe 2.08