Lineage for d4awjk1 (4awj K:17-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552434Protein Elongin C [54699] (3 species)
  7. 2552437Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. 2552486Domain d4awjk1: 4awj K:17-112 [201538]
    Other proteins in same PDB: d4awja_, d4awjc_, d4awjd_, d4awjf_, d4awjg_, d4awji_, d4awjj_, d4awjk2, d4awjl_
    automated match to d2c9wc_
    complexed with act, acy, gol, v6f

Details for d4awjk1

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (K:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4awjk1:

Sequence, based on SEQRES records: (download)

>d4awjk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4awjk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnss
teipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4awjk1:

Click to download the PDB-style file with coordinates for d4awjk1.
(The format of our PDB-style files is described here.)

Timeline for d4awjk1: