Lineage for d4apua_ (4apu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729764Domain d4apua_: 4apu A: [201471]
    automated match to d2w8ya_
    complexed with a2k, or8, so4

Details for d4apua_

PDB Entry: 4apu (more details), 1.9 Å

PDB Description: pr x-ray structures in agonist conformations reveal two different mechanisms for partial agonism in 11beta-substituted steroids
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d4apua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4apua_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

SCOPe Domain Coordinates for d4apua_:

Click to download the PDB-style file with coordinates for d4apua_.
(The format of our PDB-style files is described here.)

Timeline for d4apua_: