Class b: All beta proteins [48724] (176 folds) |
Fold b.145: AXH domain [102030] (1 superfamily) pseudobarrel; some similarity to OB-fold |
Superfamily b.145.1: AXH domain [102031] (2 families) automatically mapped to Pfam PF08517 |
Family b.145.1.1: AXH domain [102032] (2 proteins) |
Protein automated matches [196747] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries) |
Domain d4aptb_: 4apt B: [201468] automated match to d4apta_ complexed with na |
PDB Entry: 4apt (more details), 2.5 Å
SCOPe Domain Sequences for d4aptb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aptb_ b.145.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} amapptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshs pgvaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvci sltlk
Timeline for d4aptb_: