Class b: All beta proteins [48724] (177 folds) |
Fold b.145: AXH domain [102030] (1 superfamily) pseudobarrel; some similarity to OB-fold |
Superfamily b.145.1: AXH domain [102031] (2 families) automatically mapped to Pfam PF08517 |
Family b.145.1.1: AXH domain [102032] (2 proteins) |
Protein automated matches [196747] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries) |
Domain d4aptb1: 4apt B:567-689 [201468] Other proteins in same PDB: d4apta2, d4aptb2, d4aptc2, d4aptd2 automated match to d4apta_ complexed with na |
PDB Entry: 4apt (more details), 2.5 Å
SCOPe Domain Sequences for d4aptb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aptb1 b.145.1.1 (B:567-689) automated matches {Human (Homo sapiens) [TaxId: 9606]} apptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshspg vaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisl tlk
Timeline for d4aptb1: