SCOPe 2.06: Domain d4aptb1: 4apt B:567-689

Lineage for d4aptb1 (4apt B:567-689)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.145: AXH domain [102030] (1 superfamily)
   pseudobarrel; some similarity to OB-fold

4. Superfamily b.145.1: AXH domain [102031] (2 families)
   automatically mapped to Pfam PF08517

5. Family b.145.1.1: AXH domain [102032] (2 proteins)

6. Protein automated matches [196747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)

8. Domain d4aptb1: 4apt B:567-689 [201468]
   Other proteins in same PDB: d4apta2, d4aptb2, d4aptc2, d4aptd2
   automated match to d4apta_
   complexed with na

Details for d4aptb1

PDB Entry: 4apt, 2.5 Å

PDB Description: The structure of the AXH domain of ataxin-1.

PDB Compounds: (B:) ataxin-1

SCOPe Domain Sequences for d4aptb1:

Sequence; same for both SEQRES and ATOM records:

>d4aptb1 b.145.1.1 (B:567-689) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshspg
vaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisl
tlk

Timeline for d4aptb1:

• d4aptb1 first appeared in SCOPe 2.03, called d4aptb_
  
• d4aptb1 was called d4aptb_ in SCOPe 2.05
  
• d4aptb1 appears in SCOPe 2.07
  
• d4aptb1 appears in the current release, SCOPe 2.08