SCOPe 2.07: Domain d1yekl1: 1yek L:1-107

Lineage for d1yekl1 (1yek L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
   Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10

8. Domain d1yekl1: 1yek L:1-107 [20146]
   Other proteins in same PDB: d1yekh1, d1yekh2, d1yekl2
   part of Fab D2.3
   complexed with npo, zn

Details for d1yekl1

PDB Entry: 1yek, 2.1 Å

PDB Description: catalytic antibody d2.3 complex

PDB Compounds: (L:) protein (ig antibody d2.3 (light chain))

SCOPe Domain Sequences for d1yekl1:

Sequence; same for both SEQRES and ATOM records:

>d1yekl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

Timeline for d1yekl1:

• d1yekl1 first appeared (with stable ids) in SCOP 1.55
  
• d1yekl1 appears in SCOPe 2.06
  
• d1yekl1 appears in the current release, SCOPe 2.08