Lineage for d4ac7c1 (4ac7 C:1-131,C:435-483)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810354Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1810355Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1810356Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 1810357Protein alpha-Subunit of urease [51340] (4 species)
  7. 1810358Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries)
  8. 1810360Domain d4ac7c1: 4ac7 C:1-131,C:435-483 [201414]
    Other proteins in same PDB: d4ac7a_, d4ac7b_, d4ac7c2
    automated match to d4ubpc1
    complexed with edo, flc, ni, oh, so4

Details for d4ac7c1

PDB Entry: 4ac7 (more details), 1.5 Å

PDB Description: the crystal structure of sporosarcina pasteurii urease in complex with citrate
PDB Compounds: (C:) urease subunit alpha

SCOPe Domain Sequences for d4ac7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac7c1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOPe Domain Coordinates for d4ac7c1:

Click to download the PDB-style file with coordinates for d4ac7c1.
(The format of our PDB-style files is described here.)

Timeline for d4ac7c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ac7c2