SCOPe 2.05: Domain d4ac7b_: 4ac7 B:

Lineage for d4ac7b_ (4ac7 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein automated matches [192998] (1 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [193000] (2 PDB entries)

8. Domain d4ac7b_: 4ac7 B: [193003]
   Other proteins in same PDB: d4ac7a_, d4ac7c1, d4ac7c2
   automated match to d4ubpb_
   complexed with edo, flc, ni, oh, so4

Details for d4ac7b_

PDB Entry: 4ac7, 1.5 Å

PDB Description: the crystal structure of sporosarcina pasteurii urease in complex with citrate

PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4ac7b_:

Sequence; same for both SEQRES and ATOM records:

>d4ac7b_ b.85.3.1 (B:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d4ac7b_:

• d4ac7b_ first appeared in SCOPe 2.02
  
• d4ac7b_ appears in SCOPe 2.04
  
• d4ac7b_ appears in SCOPe 2.06
  
• d4ac7b_ appears in the current release, SCOPe 2.08