Lineage for d3zwxh1 (3zwx H:1-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858445Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2858579Protein automated matches [191078] (1 species)
    not a true protein
  7. 2858580Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)
  8. 2858628Domain d3zwxh1: 3zwx H:1-251 [201379]
    Other proteins in same PDB: d3zwxb2, d3zwxd2, d3zwxh2
    automated match to d3zwna_
    complexed with av1, cl

Details for d3zwxh1

PDB Entry: 3zwx (more details), 2.6 Å

PDB Description: Crystal structure of ADP-ribosyl cyclase complexed with 8-bromo-ADP- ribose
PDB Compounds: (H:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3zwxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zwxh1 c.23.14.3 (H:1-251) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

SCOPe Domain Coordinates for d3zwxh1:

Click to download the PDB-style file with coordinates for d3zwxh1.
(The format of our PDB-style files is described here.)

Timeline for d3zwxh1: