PDB entry 3zwx

View 3zwx on RCSB PDB site
Description: Crystal structure of ADP-ribosyl cyclase complexed with 8-bromo-ADP- ribose
Class: hydrolase
Keywords: hydrolase, cd38, substrate specificity
Deposited on 2011-08-03, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.20635
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwxa_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29241 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3zwxb1, d3zwxb2
  • Chain 'C':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwxc_
  • Chain 'D':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29241 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3zwxd1, d3zwxd2
  • Chain 'E':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwxe_
  • Chain 'F':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwxf_
  • Chain 'G':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zwxg_
  • Chain 'H':
    Compound: ADP-ribosyl cyclase
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29241 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3zwxh1, d3zwxh2
  • Heterogens: CL, AV1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zwxA (A:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxA (A:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zwxB (B:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxB (B:)
    aivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsyk
    dfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpg
    fnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkye
    lpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllc
    sdnpnarecrla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zwxC (C:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxC (C:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zwxD (D:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxD (D:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zwxE (E:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxE (E:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zwxF (F:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxF (F:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrlak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3zwxG (G:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxG (G:)
    ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
    fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
    nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
    pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
    dnpnarecrla
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3zwxH (H:)
    aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
    kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
    gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
    elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
    csdnpnarecrlakrfyria
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zwxH (H:)
    aivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsyk
    dfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpg
    fnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkye
    lpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllc
    sdnpnarecrla