SCOPe 2.03: Domain d3vpoa_: 3vpo A:

Lineage for d3vpoa_ (3vpo A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193902] (5 PDB entries)

8. Domain d3vpoa_: 3vpo A: [201253]
   automated match to d3vpob_
   complexed with fe, mg; mutant

Details for d3vpoa_

PDB Entry: 3vpo, 2.3 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3vpoa_:

Sequence; same for both SEQRES and ATOM records:

>d3vpoa_ a.25.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeqvdlskdiqhweslkpeer
yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

Timeline for d3vpoa_:

• d3vpoa_ is new in SCOPe 2.03-stable
  
• d3vpoa_ appears in SCOPe 2.04
  
• d3vpoa_ appears in the current release, SCOPe 2.08, called d3vpoa1