Lineage for d3vpoa1 (3vpo A:66-350)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703680Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries)
  8. 2703690Domain d3vpoa1: 3vpo A:66-350 [201253]
    Other proteins in same PDB: d3vpoa2, d3vpob2
    automated match to d3vpob_
    complexed with fe, mg; mutant

Details for d3vpoa1

PDB Entry: 3vpo (more details), 2.3 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3vpoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpoa1 a.25.1.2 (A:66-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeqvdlskdiqhweslkpeery
fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik
dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw
lkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt
ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

SCOPe Domain Coordinates for d3vpoa1:

Click to download the PDB-style file with coordinates for d3vpoa1.
(The format of our PDB-style files is described here.)

Timeline for d3vpoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vpoa2