| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries) Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor |
| Domain d1fj1c1: 1fj1 C:1-107 [20120] Other proteins in same PDB: d1fj1a2, d1fj1b1, d1fj1b2, d1fj1c2, d1fj1d1, d1fj1d2, d1fj1e_, d1fj1f_ part of Fab LA-2 against OspA |
PDB Entry: 1fj1 (more details), 2.68 Å
SCOPe Domain Sequences for d1fj1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fj1c1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveik
Timeline for d1fj1c1: