SCOPe 2.05: Domain d3v3yh2: 3v3y H:36-250

Lineage for d3v3yh2 (3v3y H:36-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d3v3yh2: 3v3y H:36-250 [201148]
   Other proteins in same PDB: d3v3yh1, d3v3yl_, d3v3ym_
   automated match to d1l9bh1
   complexed with bcl, bph, cl, dio, fe, lda, po4, spn, u10

Details for d3v3yh2

PDB Entry: 3v3y, 2.8 Å

PDB Description: Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3v3yh2:

Sequence; same for both SEQRES and ATOM records:

>d3v3yh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d3v3yh2:

• d3v3yh2 first appeared in SCOPe 2.03
  
• d3v3yh2 appears in SCOPe 2.04
  
• d3v3yh2 appears in SCOPe 2.06
  
• d3v3yh2 appears in the current release, SCOPe 2.08